top of page

CircRNA

Gene

chrY|1593443|1595532|+|2|circRNA|AKAP17A|ENSTR0000313871.7|2,3

AKAP17A

Open Reading Frame (ORF)

MPQLRSGSWRGRSFRNWSSKEKNKSAERRKRRRGSERRKGPRSRRLWQRLPSCTTRLRPWSSALLTACT

Peptide

LWQRLPSCTTR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page