top of page

CircRNA

Gene

chrY|1421657|1432377|-|4|circRNA|ASMTL|NM_001173474_DUP1|8,7,6,5

ASMTL

CircRNA UID

circASMTL(8,7,6,5)

Open Reading Frame (ORF)

LASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQTISWTPGSRNSTRKRR

Peptide

AEDLFQTISWTPGSRNSTR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

12

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page