top of page

CircRNA

Gene

chrY|1412731|1428121|—|6|circRNA|ASMTL|NM_001173474_DUP1|11,10,9,8,7,6

ASMTL

Open Reading Frame (ORF)

LSCTSCAGSCMTGQTTKSTSYSAGSPRAASQGQSWRLRDPGPGRHAGGVRTRGLSERGGIPAEPLLQAAGEALLPAPSGGPAAECQARLHPGRGHLRRPQ

Peptide

DPGPGRHAGGVR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page