top of page

CircRNA

Gene

chrY|13297706|13369349|—|18|circRNA|UTY|ENST00000382896.8|26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9

UTY

Open Reading Frame (ORF)

LAVERYEWNKLKSVKSPVPMVHLSWNMARNIKVSDPKLFEMIKGSIILQRRHMNNFCRQKTFLHK

Peptide

GSIILQRR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page