top of page

CircRNA

Gene

chr9|96949554|96972948|—|3|circRNA|HIATL2|ENST00000602917.5|4,3,2

HIATL2

Open Reading Frame (ORF)

LLSFLSAPLIGALSDVWGRKPFLLGTVFFTCFPIPLMRISPCYKALAHQVCTMLLLSSSLNSLRGAF

Peptide

ALAHQVCTMLLLSSSLNSLR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page