top of page

CircRNA

Gene

chr9|96763117|96776245|—|4|circRNA|ZNF510|NM_001314059|5,4,3,2

ZNF510

Open Reading Frame (ORF)

LLSDRTETSSPGLPNRCRRTQKGAGLDLPNQRHFFIPLPREHQTW

Peptide

GAGLDLPNQR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page