top of page

CircRNA

Gene

chr9|94085250|94095454|+|4|circRNA|PTPDC1|ENST00000375360.7|3,4,5,6

PTPDC1

CircRNA UID

circPTPDC1(3,4,5,6)

Open Reading Frame (ORF)

MEGLWCSVSYYYPRYGEGDDICLTGRKSSYPLSCRAWSNRKFRTSNTKVHKSRGAFTACHSWTHGMFHGVWR

Peptide

GAFTACHSWTHGMFHGVWR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page