top of page

CircRNA

Gene

chr9|92612614|92613018|+|1|ciRNA|CENPP|NM_001012267|7

CENPP

Open Reading Frame (ORF)

LVRSMPAENKRPKAATLKFLTRFNVFFIGRALGVAALGDFSTCPAKPPACFLWVSKGKNQKLEISLMYFVYQFLNIFINNHSKRT

Peptide

FLTRFNVFFIGR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page