top of page

CircRNA

Gene

chr9|92314266|92319356|—|3|circRNA|NOL8|ENST00000442668.6|7,6,5

NOL8

Open Reading Frame (ORF)

LTKTAAIVPQRQKLHRKSGLIQAASHLSRNHQRSHPRTLGKSKLISHFLLVIRQM

Peptide

TAAIVPQR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page