top of page

CircRNA

Gene

chr9|83975745|83976994|—|1|ciRNA|HNRNPK|NM_031263|5

HNRNPK

Open Reading Frame (ORF)

LISKLSIPVLTKAQIEQGGGVVSFKPLHILIRVHQIIHFIKQDNILIRNSDKV

Peptide

QDNILIRNSDK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page