top of page

CircRNA

Gene

chr9|77728513|77815770|—|4|circRNA|GNAQ|ENST00000286548.8|6,5,4,3

GNAQ

Open Reading Frame (ORF)

MEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGSCTISSRS

Peptide

IMYSHLVDYFPEYDGSCTISSR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page