top of page

CircRNA

Gene

chr9|71709258|71715089|-|3|circRNA|TMEM2|ENST00000377044.8|17,16,15

TMEM2

CircRNA UID

circTMEM2(17,16,15)

Open Reading Frame (ORF)

LQWDLCTVMEASQVMKVPAKRYLNLSLLGRAGITAFRVVRTSM

Peptide

AGITAFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000116,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page