top of page

CircRNA

Gene

chr9|70323482|70350471|+|9|circRNA|SMC5|NM_015110|16,17,18,19,20,21,22,23,24

SMC5

Open Reading Frame (ORF)

MDPINERRVFEMVVNTACKENTSQYFFITPKFKADGTGYLQS

Peptide

ADGTGYLQS

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page