top of page

CircRNA

Gene

chr9|676889|713464|+|2|circRNA|KANK1|ENST00000382303.5|6,7

KANK1

CircRNA UID

circKANK1(6,7)

Open Reading Frame (ORF)

LAWITTLSVSRSCWQNSRHCWLRTTVNWQKLSGNLTHRWAPSTLSSSAPCRLSTLS

Peptide

LSGNLTHR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page