top of page

CircRNA

Gene

chr9|4117767|4118881|—|1|circRNA|GLIS3|ENST00000324333.14|3

GLIS3

Open Reading Frame (ORF)

LHSPAAPGARQPEGRAGGPWRPGAAGLRRGRGPGARAHATAGARRPAARPGQPHGGAAWPAGPRQPVGRPVQDRTPGGVPGQHRRPTPRASAPSSAAAPRPPTPLPCPCAPSPPGARAPRPAAGLAPGHPGRRRGDGRHRGQALLPLDRLQRPVRPAGGARAAHREGPHRPAQRGGLHLLLGRLPSKIQALQRPL

Peptide

APRPAAGLAPGHPGRR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page