top of page

CircRNA

Gene

chr9|41031370|41053899|—|6|circRNA|PGM5P2|ENST00000613141.1|7,6,5,4,3,2

PGM5P2

Open Reading Frame (ORF)

MTQSPLDIIKLCLICGLHLHLDWMTDYWTEWHLVNTCGLLHYQEDQGSWWNHSNSQPLPWRTRGRVWSEV

Peptide

MTQSPLDIIK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page