top of page

CircRNA

Gene

chr9|38615593|38616044|-|2|circRNA|ANKRD18A|ENST00000607974.5|3,2

ANKRD18A

Open Reading Frame (ORF)

LYTARKRLVPSFSWNVAPIQTLRISTATLLSIMPCIIRGLHWQKDCFPTMQILKH

Peptide

ISTATLLSIMPCIIRGLHWQK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page