top of page

CircRNA

Gene

chr9|35684550|35685063|—|1|ciRNA|TPM2|ENST00000378292.7|6

TPM2

Open Reading Frame (ORF)

LMACVCPQKVVTPLNLSGQWRLLSAHLPSVSAPQAALSQLLGIRKGLGLLSPACCHSHNFALLFSPPPVPCCAISTVWLRCALTPCPPRHTPPAVNVGT

Peptide

VVTPLNLSGQWR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page