top of page

CircRNA

Gene

chr9|35295695|35310781|+|2|circRNA|UNC13B|ENST00000617908.4|8,9

UNC13B

CircRNA UID

circUNC13B(8,9)

Open Reading Frame (ORF)

LPQLSQPVQRWPSRFWRTRETLGGDRSSREGGSM

Peptide

LPQLSQPVQRWPSR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page