top of page

CircRNA

Gene

chr9|33900173|33912098|+|2|circRNA|UBE2R2|NM_017811|3,4

UBE2R2

Open Reading Frame (ORF)

MSPTPSPQPMSMLQLCSGNGETVKEKTKNMLKLLEWRCMHFDSSSACR

Peptide

NMLKLLEWR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page