top of page

CircRNA

Gene

chr9|27271926|27274286|-|2|circRNA|LINC00032|ENST00000425633.1|9,8

LINC00032

Open Reading Frame (ORF)

MAHRKRHSVTSEFLSKVPDEVRQRYINLFVEKYLKVCKTEDEAVYKASTNKEVIRPFRVPVPLLTSPTGIIRAQQSSTDKGCHKEWEGFY

Peptide

YINLFVEK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page