top of page

CircRNA

Gene

chr9|27009019|27048274|+|8|circRNA|IFT74|ENST00000433700.5|9,10,11,12,13,14,15,16

IFT74

CircRNA UID

circIFT74(9,10,11,12,13,14,15,16)

Open Reading Frame (ORF)

MMQDDLNFKSTEVQKSQSTAQNLTSGKKNKSEVSKKKLNRKNKQQMTLSKICLLKTKSST

Peptide

STEVQKSQSTAQNLTSGK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page