top of page

CircRNA

Gene

chr9|17226202|17309252|+|6|circRNA|CNTLN|ENST00000380647.7|3,4,5,6,7,8

CNTLN

Open Reading Frame (ORF)

MSYIFVLKPQNQMKLCSGKVLLIFRISYYKKSKKMLS

Peptide

MSYIFVLKPQNQMKLCSGK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page