top of page

CircRNA

Gene

chr9|137021890|137023052|—|4|circRNA|ABCA2|ENST00000341511.10|7,6,5,4

ABCA2

Open Reading Frame (ORF)

LLFGPSSALDSQSGLHKGQEPWSRLGGNPLFRMEPSTQRRP

Peptide

LGGNPLFRMEPSTQR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page