top of page

CircRNA

Gene

chr9|136446854|136461274|—|16|circRNA|SEC16A|NM_014866|28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13

SEC16A

Open Reading Frame (ORF)

MQKNHSFQTGLAGKGLQQLGAWPIQSLPQSPRMLWSLQ

Peptide

GLQQLGAWPIQSLPQSPR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page