top of page

CircRNA

Gene

chr9|134048082|134053590|-|5|circRNA|BRD3|ENST00000303407.11|6,5,4,3,2

BRD3

Open Reading Frame (ORF)

LPAGVSRPRRCQTPSRPKWWPGGRVVAAPSSLPRRTWRTARCPSTQARRASCRSTYATATASSGRCYPRSTRPTPGPSTSQWMPRPWSCTTTTTSSSTRWTSAP

Peptide

ASCRSTYATATASSGR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page