top of page

CircRNA

Gene

chr9|131189052|131199015|+|4|circRNA|NUP214|ENST00000359428.9|26,27,28,29

NUP214

Open Reading Frame (ORF)

LVGEANLLMRPFLKAHLPQESHPHQTPPQENLPHLAADLWHLLELLFPPPLVSWKPHRPSWESFCFQVLWLERLWEVFQDCGLAKQMILQNQPIRLHPQA

Peptide

QMILQNQPIRLHPQA

ORF Found in Long-Read

true

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page