top of page

CircRNA

Gene

chr9|128508875|128527525|+|8|circRNA|GLE1|NM_001499|2,3,4,5,6,7,8,9

GLE1

Open Reading Frame (ORF)

MDLQKAATIPVSQISTIAGCFRRMYVSSQAIFLFWMGGRARPTPYAGEPTSV

Peptide

AATIPVSQISTIAGCFRR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page