top of page

CircRNA

Gene

chr9|128487889|128492805|+|3|circRNA|ODF2|NM_153436|13,14,15

ODF2

Open Reading Frame (ORF)

MKTRLEADEVAAQLERCDKENKILKDEMNKEIEAPGNRSCKPTTNPGGEDAGRPG

Peptide

EIEAPGNR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page