top of page

CircRNA

Gene

chr9|125337017|125346941|+|5|circRNA|GAPVD1|NM_001282680|16,17,18,19,20

GAPVD1

CircRNA UID

circGAPVD1(16,17,18,19,20)

Open Reading Frame (ORF)

MIPALDSVHKLRWLRIFWTNTGMPLNGPAPVMEQWQTMKVQVPTS

Peptide

WLRIFWTNTGMPLNGPAPVMEQWQTMK

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page