top of page

CircRNA

Gene

chr9|125301982|125305149|+|2|circRNA|GAPVD1|ENST00000497580.5|3,4

GAPVD1

CircRNA UID

circGAPVD1(3,4).A

Open Reading Frame (ORF)

MLKLPLLNVANMPKFWKIHNLLMGISNWDFRRLLMENS

Peptide

MLKLPLLNVANMPK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page