top of page

CircRNA

Gene

chr9|123065347|123099549|+|12|circRNA|RABGAP1|ENST00000456584.5|15,16,17,18,19,20,21,22,23,24,25,26

RABGAP1

CircRNA UID

circRABGAP1(15,16,17,18,19,20,21,22,23,24,25,26)

Open Reading Frame (ORF)

LRKFGSLPRTVLSPGILTEHSQPMTTLRTQEEMDKIPYIKYARYFMSKKKRTQF

Peptide

KFGSLPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page