top of page

CircRNA

Gene

chr9|122853951|122865657|-|9|circRNA|RC3H2|ENST00000373670.5|17,16,15,14,13,12,11,10,9

RC3H2

CircRNA UID

circRC3H2(17,16,15,14,13,12,11,10,9)

Open Reading Frame (ORF)

LAMQQKWNSLDEGRHLTLNLLSKEIELRNGEVSIKEQKDQCHCKNVSSSK

Peptide

NGEVSIK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page