top of page

CircRNA

Gene

chr9|120980082|120981939|—|2|circRNA|C5|ENST00000223642.2|28,27

C5

Open Reading Frame (ORF)

LTTFCLKIHCQPRAPLHWPFLRMLFPWEIKLTHSFVQLFQL

Peptide

MLFPWEIK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page