top of page

CircRNA

Gene

chr9|120467859|120518645|-|7|circRNA|CDK5RAP2|ENST00000360822.7|18,17,16,15,14,13,12

CDK5RAP2

CircRNA UID

circCDK5RAP2(18,17,16,15,14,13,12)

Open Reading Frame (ORF)

LISPAWVSREMGFQIDLRLQNKQRGLKTMRLLYQERKPFRLRCAHKTSPRVQRTTDCVEALRRSPRS

Peptide

TTDCVEALR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page