top of page

CircRNA

Gene

chr9|114423313|114426413|-|4|circRNA|DFNB31|ENST00000265134.10|7,6,5,4

DFNB31

Open Reading Frame (ORF)

LGTPTPWSPTVTRVHPQAATAPPPPSARPGLGTRF

Peptide

LGTPTPWSPTVTR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page