top of page

CircRNA

Gene

chr9|114381059|114381446|-|1|circRNA|AKNA|NM_030767|2

AKNA

Open Reading Frame (ORF)

LGRRETLSQCHQPRAPRGLPPGPAAPAAPGVGPTPAARWASGFRVRRDFGRRAQAGWPMLTGTSGDSGAPGSSSVS

Peptide

GLPPGPAAPAAPGVGPTPAAR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page