top of page

CircRNA

Gene

chr9|113507286|113529264|+|6|circRNA|RGS3|NM_144488|14,15,16,17,18,19

RGS3

CircRNA UID

circRGS3(14,15,16,17,18,19)

Open Reading Frame (ORF)

LRALSSRGAAPVRSSYSCGAWSPRSSQDQMAGSCGGPPASRHMTSSHPPTNGRRTAPMGSRHGLSSATAATWYVTALMGCCSAAGSATPRWPSAGASTPCLHCPVPLPPPTPTTSSWPR

Peptide

ALSSRGAAPVR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page