top of page

CircRNA

Gene

chr9|113282645|113283482|+|3|circRNA|PRPF4|ENST00000374199.8|4,5,6

PRPF4

CircRNA UID

circPRPF4(4,5,6)

Open Reading Frame (ORF)

MKRLEEARLHKEIPETTRTSQMQELHKSLRVKKYPLSCRY

Peptide

YPLSCRY

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page