top of page

CircRNA

Gene

chr9|112403994|112418958|+|3|circRNA|HSDL2|NM_001195822|2,3,4

HSDL2

Open Reading Frame (ORF)

LLSMVCLCMCLEWQKNLKVKLQSMHYGLKQEAGRMYSFYHRCKPWHWQSYCIESSKGWSKYCYCCKDRPATSKTSRHNLYCC

Peptide

LQSMHYGLKQEAGR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page