top of page

CircRNA

Gene

chr9|112268048|112276013|—|2|new|PTBP3|ENST00000458258|63,117|0,7848

PTBP3

Open Reading Frame (ORF)

MGMTARNLNEIDLPVRLPVFSIFEKFHVMSPKQRSYH

Peptide

MGMTARNLNEIDLPVR

ORF Found in Long-Read

true

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Novel in Short-Read

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page