top of page

CircRNA

Gene

chr9|112250928|112276013|-|5|circRNA|PTBP3|NM_001244898|7,6,5,4,3

PTBP3

CircRNA UID

circPTBP3(7,6,5,4,3)

Open Reading Frame (ORF)

LVMASHPLNPLWLLLLLMGMTARNLNEIDLPVRLPVFSIFEKFHVMSPKQRSYH

Peptide

LVMASHPLNPLWLLLLLMGMTAR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page