top of page

CircRNA

Gene

chr9|111647106|111649923|+|2|circRNA|DNAJC25|ENST00000313525.3|2,3

DNAJC25

CircRNA UID

circDNAJC25(2,3)

Open Reading Frame (ORF)

MRMKKHEKIMITCWIIQKSTTAITTTTIAGAWPLRWMLE

Peptide

IMITCWIIQK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page