top of page

CircRNA

Gene

chr9|111375229|111376475|—|1|ciRNA|KIAA0368|ENST00000338205.9|36

KIAA0368

Open Reading Frame (ORF)

LLLSGINNSPNTRNSWSKFVLQETTTYQELSINLHL

Peptide

LLLSGINNSPNTR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page