top of page

CircRNA

Gene

chr9|110136126|110138539|+|1|circRNA|PALM2—AKAP2|NM_007203|8

PALM2-AKAP2

Open Reading Frame (ORF)

LKLRLSAQKSLRACLSHLRCLLLFKRKGMYYQRFCLLKTGRSGKGGPPSHCQLCSPVARLTWRRPGPKEAISASTRRQLS

Peptide

EAISASTR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page