top of page

CircRNA

Gene

chr9|108874894|108931201|—|35|circRNA|IKBKAP|ENST00000374647.9|36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

IKBKAP

Open Reading Frame (ORF)

LQIVSWHLISNRRLRFLFLRLMIHQGIVVLVSWESLHHAKSEIISDPGVQGYSRSRESSVLLSPN

Peptide

SEIISDPGVQGYSR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page