top of page

CircRNA

Gene

chr9|106972004|106984409|+|3|circRNA|ZNF462|NM_021224|8,9,10

ZNF462

Open Reading Frame (ORF)

MRPSTRRNWTATFGMSIRLIIFRAPRCSAAVEPLSVSCPGKEQQPC

Peptide

APRCSAAVEPLSVSCPGK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page