top of page

CircRNA

Gene

chr9|105574944|105635148|+|9|circRNA|FKTN|NM_001198963|3,4,5,6,7,8,9,10,11

FKTN

CircRNA UID

circFKTN(3,4,5,6,7,8,9,10,11)

Open Reading Frame (ORF)

LFPKFTLCWTEFVDMKVHVPCETLEYIEANYENKIIFLSKSKKMKTTEILSKDNQVSSTD

Peptide

VHVPCETLEYIEANYENK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page