top of page

CircRNA

Gene

chr9|100547743|100561520|+|3|circRNA|MSANTD3-TMEFF1|NM_001198812|6,7,8

MSANTD3-TMEFF1

CircRNA UID

circMSANTD3-TMEFF1(6,7,8)

Open Reading Frame (ORF)

MLVIKEKMFILETTCLALKTSMVTASMENVNSSILLRRLLVGVYVI

Peptide

MFILETTCLALKTSMVTASMENVNSSILLR

ORF Found in Long-Read

false

Peptide Length

30

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

30

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page