top of page

CircRNA

Gene

chr9|100016321|100052532|-|5|circRNA|ERP44|ENST00000262455.6|8,7,6,5,4

ERP44

CircRNA UID

circERP44(8,7,6,5,4)

Open Reading Frame (ORF)

MVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEVSFQSDVASNF

Peptide

EITFENGEVSFQSDVASNF

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

10

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page